PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011080319.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 166aa    MW: 18469.8 Da    PI: 7.5721
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011080319.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.86.2e-46131121100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+a+la
  XP_011080319.1  13 PCAACKLLRRRCAEDCVFAPYFPADEPHKFASVHKVFGASNVNKMLQELPEHHRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDMLQAQLA 107
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+++e
  XP_011080319.1 108 LAQAE 112
                     99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0412113IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-4513110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MKESSRKQGA PSPCAACKLL RRRCAEDCVF APYFPADEPH KFASVHKVFG ASNVNKMLQE  60
LPEHHRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID MLQAQLALAQ AEVVHLRMRQ  120
LSSTANYNTP ENASPSSRGR QPHHAKSHFN MDMAMEEANV DDSFWP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080319.11e-123PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE92e-71LBD4_ARATH; LOB domain-containing protein 4
TrEMBLM1AGH31e-94M1AGH3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000222863e-94(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-66LOB domain-containing protein 4